SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A009MEF4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A009MEF4
Domain Number 1 Region: 49-169
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000994
Family SMI1/KNR4-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A009MEF4
Sequence length 170
Comment (tr|A0A009MEF4|A0A009MEF4_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:EXB68200.1} KW=Complete proteome OX=1310652 OS=Acinetobacter sp. 1475718. GN=J551_3810 OC=Acinetobacter calcoaceticus/baumannii complex.
Sequence
MNSVHEIIAKIHNEWEIEPKKAIQRGMECPFPLQCSLNLKSKIYSQIPQVLLPKVLEDFY
TVSNGADLFKDQEYGQWGLKLYSIEEVIFASKIYKINRNNDALQSDLIIGEFYGDSDLLL
VRCDPNSDDYGSIFVVLPIDQRQDWYIVANTFQEFISKFYETQGDKFWEP
Download sequence
Identical sequences A0A009MEF4 A0A010VJ07 A0A011JKJ2 A0A022KF75 A0A062DPC9 A0A075MD93 A0A1V2UQ61 B0V427 K9A974 K9B3K6 L9LVL7
509173.p3ABAYE0044 gi|169786921|ref|YP_001708733.1| gi|169786921|ref|YP_001708733.1|NC_010404 gi|447012314|ref|WP_001089570.1|NZ_CM001803 WP_001089570.1.10172 WP_001089570.1.15127 WP_001089570.1.17255 WP_001089570.1.19659 WP_001089570.1.19727 WP_001089570.1.20972 WP_001089570.1.22540 WP_001089570.1.24272 WP_001089570.1.27093 WP_001089570.1.28356 WP_001089570.1.28666 WP_001089570.1.29521 WP_001089570.1.32082 WP_001089570.1.33112 WP_001089570.1.33872 WP_001089570.1.33990 WP_001089570.1.34068 WP_001089570.1.34672 WP_001089570.1.3493 WP_001089570.1.370 WP_001089570.1.38165 WP_001089570.1.38667 WP_001089570.1.39054 WP_001089570.1.40165 WP_001089570.1.41195 WP_001089570.1.41946 WP_001089570.1.43322 WP_001089570.1.44199 WP_001089570.1.44518 WP_001089570.1.44895 WP_001089570.1.45158 WP_001089570.1.45253 WP_001089570.1.54053 WP_001089570.1.5629 WP_001089570.1.57061 WP_001089570.1.5804 WP_001089570.1.60333 WP_001089570.1.65543 WP_001089570.1.65610 WP_001089570.1.68333 WP_001089570.1.68495 WP_001089570.1.69405 WP_001089570.1.70636 WP_001089570.1.74342 WP_001089570.1.75893 WP_001089570.1.77264 WP_001089570.1.79254 WP_001089570.1.83027 WP_001089570.1.83233 WP_001089570.1.8589 WP_001089570.1.9021 WP_001089570.1.90720 WP_001089570.1.91114 WP_001089570.1.93042 WP_001089570.1.9318 WP_001089570.1.98696 HMPREF0013_03494T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]