SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A009QEX0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A009QEX0
Domain Number - Region: 48-105
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0272
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number - Region: 186-260
Classification Level Classification E-value
Superfamily RecG, N-terminal domain 0.0523
Family RecG, N-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A009QEX0
Sequence length 280
Comment (tr|A0A009QEX0|A0A009QEX0_ACIBA) Uncharacterized protein {ECO:0000313|EMBL:EXC08882.1} KW=Complete proteome OX=1310607 OS=Acinetobacter baumannii 625974. GN=J506_1073 OC=Acinetobacter calcoaceticus/baumannii complex.
Sequence
MHAGLKDASVTDQQTTKANVEYKFVLDRSEIDLPFNLGQELEIEWTGNIYCTSCGAKTPK
SYSQGHCFKCFKTKAECDLCIMKPETCHYHLGTCREDDFAHSVCFQPHIVYLANSSALKV
GITRVSHMPGRWLDQGATQALPILKVGSRRLSGQLETMFGSLIADKTDWRKLLKGEAEPL
NLIEQRDQLIEEFAPKIQTIREEFSQNLEFNETVELLENELPREFVYPVEQYPEKIKSLN
LDKTPKIRGVLQGIKGQYLIFDIGVINIRKYTGYELIVRA
Download sequence
Identical sequences A0A009QEX0 A0A062FK81 A0A0J8W0P7 L9P0K3
gi|523523432|ref|YP_008209511.1| gi|523531009|ref|YP_008217036.1| gi|523527119|ref|YP_008213150.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]