SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A009QSC0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A009QSC0
Domain Number 1 Region: 93-158
Classification Level Classification E-value
Superfamily General secretion pathway protein M, EpsM 0.00000549
Family General secretion pathway protein M, EpsM 0.0089
Further Details:      
 
Weak hits

Sequence:  A0A009QSC0
Domain Number - Region: 18-76
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 0.0759
Family C-terminal, gelsolin-like domain of Sec23/24 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A009QSC0
Sequence length 159
Comment (tr|A0A009QSC0|A0A009QSC0_9GAMM) Type II secretion system (T2SS), M family protein {ECO:0000313|EMBL:EXC29112.1} KW=Complete proteome OX=1310637 OS=Acinetobacter sp. 809848. GN=J536_1105 OC=Acinetobacter calcoaceticus/baumannii complex.
Sequence
MKMLAQVQNRFDQWIEQVNQYLDRLTVRERIMVVFTTIFVVVAIIGASLWKMHSLAEQQQ
QRLNDLKDLMVWMQSNAVTMKPASELELGQAEKIQRVAQQQGLTVTSQQNGEQLQIIVTH
QNYAILANFLTQLAQMGLSIEKMEMISSEGQIKLTATVQ
Download sequence
Identical sequences A0A009QSC0
WP_032062839.1.34178 WP_032062839.1.9696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]