SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A009RAV2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A009RAV2
Domain Number - Region: 32-74
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.000759
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A009RAV2
Sequence length 132
Comment (tr|A0A009RAV2|A0A009RAV2_ACIBA) Uncharacterized protein {ECO:0000313|EMBL:EXC38231.1} KW=Complete proteome OX=1310653 OS=Acinetobacter baumannii 951631. GN=J552_2317 OC=Acinetobacter calcoaceticus/baumannii complex.
Sequence
MSLNAYSDDNDYYNQGFEKEGIVSIWAGILGEDVDPDLDILRDLCGVGYYNLDDQETNNS
NFEMISLNELLEDLSYSKSFINEVIDAAFDKGIVDCRWVIVQYDFDYNPFKVKRRIAKDP
IFIGSFKYSVES
Download sequence
Identical sequences A0A009RAV2 A0A062DDP3 A0A062F431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]