SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A010K7Z2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A010K7Z2
Domain Number 1 Region: 23-160
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000916
Family SMI1/KNR4-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A010K7Z2
Sequence length 184
Comment (tr|A0A010K7Z2|A0A010K7Z2_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:EXE62173.1} KW=Complete proteome OX=1310681 OS=Acinetobacter sp. 1542444. GN=J580_1179 OC=Acinetobacter calcoaceticus/baumannii complex.
Sequence
MTDFVKELSACRVEGTQLPFYPEKVQGYTEQEVELIAKNLNLDIHGQFRDFLLQIGKCSG
GLLLSDEFYMYDYRCEKYFFINYQKNIQEDDYMFDNQGKLNPVGKKIFFLSCEYETYLYY
LFTSEQDNYVWFLDSAESAIWEKTNMTLLDYLKNYVFEKTKRNRFIDFDLTEEQINRSIT
GRLL
Download sequence
Identical sequences A0A010K7Z2 A0A2I6LVT7
WP_032004079.1.59526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]