SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A010PL93 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A010PL93
Domain Number 1 Region: 1-140
Classification Level Classification E-value
Superfamily Ribosomal protein L13 8.24e-57
Family Ribosomal protein L13 0.00000823
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A010PL93
Sequence length 143
Comment (tr|A0A010PL93|A0A010PL93_FINMA) 50S ribosomal protein L13 {ECO:0000256|HAMAP-Rule:MF_01366, ECO:0000256|RuleBase:RU003878, ECO:0000256|SAAS:SAAS00725370} KW=Complete proteome OX=1459804 OS=Finegoldia magna ALB8. GN=BA93_03275 OC=Finegoldia.
Sequence
MKTYIPKKDDIQRKWYVVDATDVVLGRLSTEVASILRGKNKPMFTPNADVGDYVIVINAE
KVKLTGKKLEQKELRHYTGYAGGLKSITYKDLMEKDPERAVTHAIVGMLPHNSLGRQMAK
KLRVYRGADHDHIAQNPEVLEIK
Download sequence
Identical sequences A0A010PL93 A0A233W6Q8
WP_035111468.1.16990 WP_035111468.1.3294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]