SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A010QUG7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A010QUG7
Domain Number 1 Region: 62-146,248-363
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000698
Family G proteins 0.045
Further Details:      
 
Weak hits

Sequence:  A0A010QUG7
Domain Number - Region: 556-619
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 0.0589
Family FAT domain of focal adhesion kinase 0.0051
Further Details:      
 
Domain Number - Region: 317-377,416-465
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0876
Family Pseudo ankyrin repeat 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A010QUG7
Sequence length 951
Comment (tr|A0A010QUG7|A0A010QUG7_9PEZI) Uncharacterized protein {ECO:0000313|EMBL:EXF80275.1} KW=Complete proteome; Reference proteome OX=1445577 OS=Colletotrichum fioriniae PJ7. GN=CFIO01_08512 OC=Colletotrichum.
Sequence
MADASILTNIGDRVRVKEKAREFGLGILQEIPKILQHISNSSHKQDVRDWEMNLLNLKRT
SLSREILVGVQGETGLGKSSLLNELLRSEIVPTSQLEACTAAVCIYGYNHEVGENKRYRA
KVTFKSWATVEAELTALKEELAESDNQHEAQDDDDADHSEGCSYYSKRNIDMVCAWSGLK
EEDIRSLSPIEIMQKGNFNKIRNRGLRIPTDEKTCSKIISAPNANKFKKILRPFTESVDL
NSHRTQYWPLVEQIEVYLKAPILRHGIKLVDLPGTQDALSFRAEIAETFQDRLAKQIVVS
PASRAGDNKAAADLIFTENDLMKFHLDNKFKDDSLCVAITKIDDIQTANAAEEFPTREII
ELHHRLRGAPSEESEDDEFNSEAEDYTRVSVKKKGGSNKRRHASGASRDGKRQKVDSYED
DESMMTRLVEAQLEENQAMEEGESRLMFLCIQERNRKMVQNVVESLLKAAKSHASSQAIA
SSLPAVVPLSSHAYKKMKNGKNATGFPTLESTGIPALGNWLTDTSLPIREAWVDSDLHHI
QVLFDAVHGWTQDEFNTLPVLTTDEKKKVRQAVREVNDDLKEIIEKVRIKIQRQLITMKP
LRKKNLVKTYVKIHENGENQLERSCNNLKHAVKAWERKNPRGHTSSAGKHEKVHWGTYKA
SIKRHGGLYRTVPKKGAVRRTFNWMADVHTSFWRGHHEKWQTAFSRNFPTLKDKVRGTVH
LAFDQWIRILLDNEELPTSFRDMVRKNSYKMENVFLFFIDKIVASMDNLRGKALRMSKVD
VLNTLTKEMRPGFEAALSKKGPNIMKKQSAEISEHVENIGFGMFEMVRDDLEAKLRDEVH
QLMLATRRYWQDPKEGCGVMMHKEFERISTRLCANGAKKNDEETGIDEATEKKLVDVIGV
WRKEWQQVEARLPQAAPLVAFDENDDDDDAGNEFAKEDEIALKMEPGIGEE
Download sequence
Identical sequences A0A010QUG7
XP_007596072.1.78992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]