SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A010RNF3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A010RNF3
Domain Number 1 Region: 139-227,288-354
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 7.85e-19
Family SMI1/KNR4-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A010RNF3
Sequence length 541
Comment (tr|A0A010RNF3|A0A010RNF3_9PEZI) SMI1/KNR4 family protein {ECO:0000313|EMBL:EXF73678.1} KW=Complete proteome; Reference proteome OX=1445577 OS=Colletotrichum fioriniae PJ7. GN=CFIO01_02448 OC=Colletotrichum.
Sequence
MANTFGFGAAMRSLWHDLTSYDRHSTIDSPHRTGRHVPLNRQSGILTSVATASESRADVS
SPFADDYNRFSRENSYQGGGMPYTPTSPNPSAPYSPGLRSQSARRESQHDGFELQSPGDV
PMQSFQDGSPPPPPVSHSWKKIDAWAEEHYPELWDQLCEGCTDNDLNELEHQLDCSLPLD
VRESLMVHDGQERLGMPTGIIFGSMLLDCEEIVQEWDQWRKVNQEFLSEAAYQRPAALPK
ALGSSNQASSSREPASPAAANNGSWRQDLIARQDCVPPNAVQRSYAHPAWIPLVRDWGGN
NLAVDLAPGPNGKWGQIVLFGRDYDTKYVIARSWAHFLAMVADDLSSGKWFVDEETNELK
LREFKETRVEPPYFGILRWRMDQKYGRRAAKRRSVAPTNRAGSPAGSGANSPYTSASPTS
AEPNGEQRGRSMQRLGGTSPIASPIRPGYGKSSPLARVAEETPLPELQTNGLKPTKLVEV
ETPRPSEETPKGSRVSLLSHVETAEGEGKENANPAGKMNGTAKANGKQPEVSEEPMKEIE
I
Download sequence
Identical sequences A0A010RNF3
XP_007602646.1.78992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]