SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A010RQH5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A010RQH5
Domain Number 1 Region: 76-246
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6e-40
Family G proteins 0.00000836
Further Details:      
 
Domain Number 2 Region: 10-78
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 1.83e-22
Family Transducin (alpha subunit), insertion domain 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A010RQH5
Sequence length 251
Comment (tr|A0A010RQH5|A0A010RQH5_9PEZI) Guanine nucleotide-binding protein alpha-2 subunit {ECO:0000313|EMBL:EXF82716.1} KW=Complete proteome; Reference proteome OX=1445577 OS=Colletotrichum fioriniae PJ7. GN=CFIO01_09855 OC=Colletotrichum.
Sequence
MAHILVEHEINAQDPLPRDYLQPVKELWVDGGVKQAIAKGNEFALHDNLAYFCDDLDRIW
DASYEPTDQDLLRSRLRTTGITETVFDLGQLTYRMFDVGGQRSERKKWIHCFENVNCLLF
LVAISGYDQCLVEDKDGNQMNEALMLWESIANSHWFTKSALILFLNKMDLFKEKLPNNPI
TSHGFTDYHGPAEDWKSASKYFLDKFRALNRNTEKEIYGHFTNATDTNLLKITMGSVQDM
IIQRNLKQLIL
Download sequence
Identical sequences A0A010RQH5
XP_007593650.1.78992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]