SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A010SHU9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A010SHU9
Domain Number 1 Region: 560-711
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.44e-29
Family Regulator of G-protein signaling, RGS 0.00073
Further Details:      
 
Domain Number 2 Region: 422-534
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.09e-27
Family DEP domain 0.0044
Further Details:      
 
Domain Number 3 Region: 246-373
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000771
Family PadR-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A010SHU9
Sequence length 735
Comment (tr|A0A010SHU9|A0A010SHU9_9PEZI) Domain found in Dishevelled {ECO:0000313|EMBL:EXF84368.1} KW=Complete proteome; Reference proteome OX=1445577 OS=Colletotrichum fioriniae PJ7. GN=CFIO01_13508 OC=Colletotrichum.
Sequence
MAAVSKTSRPPNHEPLSNKASSQPLTHKANPNPTSANPRSTATTTTATSSTPLPSAAATA
TATTSTSSSTDPYHAHQHQQLQQQLAPSVNRPHYRSHHHSPSTSSLYKLQRSGGIFGFAA
AAFDKTQSALATFSSDQSVRQRASSSALGRASLTPDSASDYSANLGSQDKYPRYTSPSNY
SSSSSSTLNNIEGKYPSQVSLVQDIPSQPYSETDPTRPLPIRLPSIESKMHQTSSRLLRM
TDDDRPFTKDFKDLYSTLIVSLLPLSAHRVRLTRVENTFLSEDAINNLGSLKFSQSNRMP
DPKDPSRIVTTTTTTTFSMAKDMARSICQKFLEARFIESADGKYQQVYNMKGSVWQLTPK
GVTVLDRFCSRNGIQQKSISDLVGATLSQLVILERDGQTDKLITDRGTIEVIFRRFIGTH
GPNVKSSVSSADSDSLSDYKDGLTGVKMASERKVNGKTYKDTFTGKAATDWLMDCCTTVD
RRETYDIASLFVEYDLMEPVVQDRAHMAQYPSNNLFQPTKHAIYQLTAKGKDLINGLGSR
GRTSESEVVTPSRNAIARDSNTQRLDKILNDAALRLLFRENLRETHCEENLSFYLDVDDF
VRSCRQAIRVAQKNPNASSMDGIKEIMAQAYGIYNAFLAPGSPCELNIDHQLRNNLATRM
TKAVGQDVAMIDTLQEVMSLFEDAQNAVFKLMASDSVPKFLRSPKYEHTLKNYDFDSVTG
GGRGLERSTSRSNRK
Download sequence
Identical sequences A0A010SHU9
XP_007591990.1.78992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]