SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A010ZXF7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A010ZXF7
Domain Number - Region: 98-160
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00126
Family SMI1/KNR4-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A010ZXF7
Sequence length 225
Comment (tr|A0A010ZXF7|A0A010ZXF7_9BACL) Uncharacterized protein {ECO:0000313|EMBL:EXG83319.1} KW=Complete proteome; Reference proteome OX=915437 OS=Saccharibacillus sacchari DSM 19268. GN=SacsacDRAFT_0285 OC=Saccharibacillus.
Sequence
MKALHELLSENSAWNPTEEAIKSAGNEVVVLERDRPQAEQTLVDLQMSDKATLGAVVLNT
GGLLIDGGWLRVLGSGHPKIAGDIRSWNALGPDPIALKFKPEGYVIVAYDIAGGFFAVNN
GAFNDHSPNIYYFAPDTLEWEDTEKGYTDFLHWALNGDLQQYYATFRWTGWEKDARMLNG
GQAMMIYPFLWSEEGRDVNKTDRNPVPVAELWDLQQDMRKQLFGS
Download sequence
Identical sequences A0A010ZXF7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]