SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A011LY22 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A011LY22
Domain Number - Region: 61-155
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0188
Family SMI1/KNR4-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A011LY22
Sequence length 210
Comment (tr|A0A011LY22|A0A011LY22_MANHA) Uncharacterized protein {ECO:0000313|EMBL:EXI62103.1} KW=Complete proteome OX=1450449 OS=Mannheimia haemolytica serotype A1/A6 str. PKL10. GN=AK33_08335 OC=Pasteurellaceae; Mannheimia.
Sequence
MKSLEELLDKQSAWLILRDWFAQAKNHYEILVSYPEDAGSALIGMQLSTRSPLGAIVYET
GGIFIDHGWLRILGSGNEKLPRGLFDWNFGKTFKQSGEQPSHLLVADDAIGGYFAINAGG
IGDKVGQIYYHHPKKQQWECLSLSYSEFLGWALSGDLNAFYQALRWENWQADIAKLQGHQ
ILDLESKIAVPIERHYQGVFAPENMGYSVA
Download sequence
Identical sequences A0A011LY22
WP_042803412.1.20148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]