SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A011M723 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A011M723
Domain Number - Region: 52-91
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.0262
Family Hormone receptor domain 0.015
Further Details:      
 
Domain Number - Region: 108-149
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0604
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A011M723
Sequence length 224
Comment (tr|A0A011M723|A0A011M723_9PROT) Uncharacterized protein {ECO:0000313|EMBL:EXI65433.1} KW=Complete proteome; Reference proteome OX=1454001 OS=Candidatus Accumulibacter sp. SK-12. GN=AW08_03231 OC=Candidatus Accumulibacter.
Sequence
MAVHRFKRQLGGEVLLDICFACQGIWFDEHESAQLAPAGVLDLFRLLHEHQVDQRQPWST
VLRCPRCREALLNCLDSTRAGRFAYGRCPQRHGRYSAFAAFMIEKGFVRQLSGGEVAELA
RRVRTIRCASCGAPVDITRDHVCNHCRSPIVILDPDAVRTALDDFGSKARRQEAADPHAI
ADALIANERQKSLHSRQARKDVLETELSDLVVGGIETIWNLIRR
Download sequence
Identical sequences A0A011M723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]