SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A011NGW3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A011NGW3
Domain Number - Region: 4-36
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.00241
Family Rubredoxin 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A011NGW3
Sequence length 113
Comment (tr|A0A011NGW3|A0A011NGW3_9PROT) Putative regulatory protein, FmdB family {ECO:0000313|EMBL:EXI74466.1} KW=Complete proteome; Reference proteome OX=1454000 OS=Candidatus Accumulibacter sp. SK-11. GN=AW07_01697 OC=Candidatus Accumulibacter.
Sequence
MPIYAYRCASCGFANDHLQKLSDPALDTCPQCGQATYVKQVTAAGFQLKGSGWYVTDFKG
GKTPPPSSKETPAGSKETPAASEGATAADSNKAAAQPAAAAGSTDGASTCAGN
Download sequence
Identical sequences A0A011NGW3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]