SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A011P5T6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A011P5T6
Domain Number - Region: 5-53
Classification Level Classification E-value
Superfamily t-snare proteins 0.0141
Family t-snare proteins 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A011P5T6
Sequence length 100
Comment (tr|A0A011P5T6|A0A011P5T6_9PROT) Uncharacterized protein {ECO:0000313|EMBL:EXI90323.1} KW=Complete proteome; Reference proteome OX=1454004 OS=Candidatus Accumulibacter sp. BA-93. GN=AW11_01027 OC=Candidatus Accumulibacter.
Sequence
MSLKEAKDAYIGKLKLQLDEWSADLDAMEARARQADAGFKESFNAKAEELRYQKTLAQGR
INALHEAADDAWEELRNGSENIWSTVRQTFADAKAKFDNK
Download sequence
Identical sequences A0A011P5T6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]