SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A011U805 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A011U805
Domain Number 1 Region: 15-72
Classification Level Classification E-value
Superfamily TrpR-like 0.000000000000105
Family SPO1678-like 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A011U805
Sequence length 91
Comment (tr|A0A011U805|A0A011U805_9RHIZ) Transposase {ECO:0000313|EMBL:EXL02241.1} KW=Complete proteome; Reference proteome OX=69279 OS=Aquamicrobium defluvii. GN=BG36_15860 OC=Phyllobacteriaceae; Aquamicrobium.
Sequence
MRQKSGTGKAPAQQVIKDIRRATRKQYGAEEKIRIVLEGLRGEESIAALCRREGIAESLY
YNWSKEFLEAGCRFTLQSGTLALCARKLHSN
Download sequence
Identical sequences A0A011U805 A0A031LX62

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]