SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A011UJF2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A011UJF2
Domain Number 1 Region: 4-71
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 1.17e-17
Family Phage repressors 0.07
Further Details:      
 
Domain Number 2 Region: 117-192
Classification Level Classification E-value
Superfamily Superoxide reductase-like 0.0000000000000772
Family Superoxide reductase-like 0.0079
Further Details:      
 
Weak hits

Sequence:  A0A011UJF2
Domain Number - Region: 80-109
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.00651
Family Desulforedoxin 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A011UJF2
Sequence length 195
Comment (tr|A0A011UJF2|A0A011UJF2_RUMAL) XRE family transcriptional regulator {ECO:0000313|EMBL:EXM40794.1} KW=Complete proteome OX=1341156 OS=Ruminococcus albus SY3. GN=RASY3_03540 OC=Ruminococcus.
Sequence
MDQIKTGALIRQLRLSAGLTQKQLAEKVNVSDKAVSKWECGNGAPDVSLLTDLAEVFGTD
VNTLLSGSKDINESEKGDMKKIRFYVCKDCGGIMTSTSEASVSCCGNRLSPIVPKKAEGD
DVLKTEVIDGELFVTADHEMTKQHYISFLAYVCDSTVMMFRQYPEWKMQARLPFVRMGRL
VWYCTEHGAFYQDIK
Download sequence
Identical sequences A0A011UJF2
WP_037285107.1.53689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]