SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A011UV98 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A011UV98
Domain Number 1 Region: 76-253
Classification Level Classification E-value
Superfamily Rhomboid-like 1.83e-41
Family Rhomboid-like 0.0009
Further Details:      
 
Weak hits

Sequence:  A0A011UV98
Domain Number - Region: 11-39
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00549
Family B-box zinc-binding domain 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A011UV98
Sequence length 281
Comment (tr|A0A011UV98|A0A011UV98_9MICO) Protease {ECO:0000313|EMBL:EXJ52092.1} KW=Complete proteome OX=1451261 OS=Microbacterium sp. MRS-1. GN=AS96_05965 OC=Microbacterium.
Sequence
MTDSDIRTNPDNFCYRHPDRQSFVLCQRCLRTICGECQTPLPVGVICPECLAEQRKAASA
SVTRMPRRRPSGIDGKPVVTYTLVIVTSVFYLIGLIPGIGLYVQNLLAFHAQLAYVQPWR
LLTVTLVHASIFHIAFNMLALWALGRSLEPLLGRWRFLALYLLSALGGSVLTALLAPNTW
VVGASGAVWGLLGAMFVIGRHLGANVTAIAVLLGINLVITFLPGSNIAWQAHIGGGLVGA
LIGVIFARTRKIRQRALQIWLLVAVGVGLLGALAVPLYLYA
Download sequence
Identical sequences A0A011UV98
WP_036286754.1.73084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]