SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A011VZZ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A011VZZ4
Domain Number 1 Region: 15-140
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000000102
Family SMI1/KNR4-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A011VZZ4
Sequence length 142
Comment (tr|A0A011VZZ4|A0A011VZZ4_RUMAL) Uncharacterized protein {ECO:0000313|EMBL:EXM40118.1} KW=Complete proteome OX=1341156 OS=Ruminococcus albus SY3. GN=RASY3_06015 OC=Ruminococcus.
Sequence
MYTDFLSKLPDTAAYEKPTQEKINDADKEFYYLFEVGLPKDYIKLLHHTNGLSYDGRSIC
GVYEEEFLTEYPRKKSMDIIRFNSSFRDMTDITDYILLGKSSIDYIVYNTSEKKYQILSN
GTMESFGTFDSFIELLYAFFEV
Download sequence
Identical sequences A0A011VZZ4
WP_037286061.1.53689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]