SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A013SXY7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A013SXY7
Domain Number 1 Region: 49-170
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000719
Family SMI1/KNR4-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A013SXY7
Sequence length 174
Comment (tr|A0A013SXY7|A0A013SXY7_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:EXS25781.1} KW=Complete proteome OX=1310791 OS=Acinetobacter sp. 742879. GN=J690_3514 OC=Acinetobacter calcoaceticus/baumannii complex.
Sequence
MKLLNEALRKIETLWSKEPKHAVHRGEKTFFQFRCILNNGISPDRFGDIDLQLPTEFKEF
LLVSNGADLFKDEEYGQWGARIFSIDELQSSNKYYRELRPKDFTKGDLIIGEFYGDSDLL
LLRCDPESKDYGAVLIALPFDNRSDWYCSANFENFITDYVNSEGDKFWEIRTKT
Download sequence
Identical sequences A0A013SXY7 A0A143IYE9
WP_032038301.1.21058 WP_032038301.1.40165 WP_032038301.1.60739 WP_032038301.1.62345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]