SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A013TUN5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A013TUN5
Domain Number 1 Region: 9-146
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.44e-22
Family SMI1/KNR4-like 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A013TUN5
Sequence length 147
Comment (tr|A0A013TUN5|A0A013TUN5_9GAMM) SMI1 / KNR4 family protein {ECO:0000313|EMBL:EXS33438.1} KW=Complete proteome OX=1310764 OS=Acinetobacter sp. 826659. GN=J663_2775 OC=Acinetobacter calcoaceticus/baumannii complex.
Sequence
MKMKIDLLNRLSEFYKDNPEMKGVPLTLNDINQVETTLQIKLPDDYKLFVSTYGGSYAGL
AIYGLKNAEMMGDETVIDLTNRARKLLDDLKVNNYILKSIVISDDGAGNPIFINEKGEVY
IYYVDNDEYEKLGDSLGEVIEEKFQEW
Download sequence
Identical sequences A0A013TUN5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]