SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A013VAK2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A013VAK2
Domain Number 1 Region: 16-66
Classification Level Classification E-value
Superfamily TrpR-like 0.00000000000188
Family SPO1678-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A013VAK2
Sequence length 125
Comment (tr|A0A013VAK2|A0A013VAK2_9SPHN) Transposase {ECO:0000313|EMBL:EXS68359.1} KW=Complete proteome; Reference proteome OX=1461752 OS=Sphingobium sp. Ant17. GN=BF95_06955 OC=Sphingomonadaceae; Sphingobium.
Sequence
MDEIISDVFPGVRRLDVLETGRRRRWTDDAKQRIVEEAFQRGVSVLTVARRHDVDPSQIY
DWRRRLFPQISRGISGFAPVVVTPDCPVPSSRGQMEIVCGNGRRIIVDRDAMSPRCFRVL
AGLEG
Download sequence
Identical sequences A0A013VAK2
WP_051520190.1.37935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]