SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A013WM76 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A013WM76
Domain Number 1 Region: 6-168
Classification Level Classification E-value
Superfamily Trimeric LpxA-like enzymes 9.56e-44
Family Serine acetyltransferase 0.00063
Further Details:      
 
Weak hits

Sequence:  A0A013WM76
Domain Number - Region: 185-215
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0248
Family Mitotic arrest deficient-like 1, Mad1 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A013WM76
Sequence length 237
Comment (tr|A0A013WM76|A0A013WM76_9SPHN) Serine acetyltransferase {ECO:0000256|PIRNR:PIRNR000441} KW=Complete proteome; Reference proteome OX=1461752 OS=Sphingobium sp. Ant17. GN=BF95_04185 OC=Sphingomonadaceae; Sphingobium.
Sequence
MLRNLISYLDSVKSRDPAPRSRAEILLYPGVWSLAYHRVAHRLYGARLYFLARLVNHLSR
FLTGNDIHPGAKIGKRFFIDHGFTVIGETAEIGDDVTLYQNVTLGGTDPANGIAGKRHPT
LGDGVIIGSGAQVLGPVTVGARARVGANAVVTKNVAEGATMVGIPARAMLVDVTAYQRDF
MPYGTPCSDCFDPEKQKLELLQCEVEQLQKRLAELMVEKQRPSLPDEATLFQERDRA
Download sequence
Identical sequences A0A013WM76
WP_043149555.1.37935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]