SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A014B8G1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A014B8G1
Domain Number - Region: 12-60
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0366
Family Pseudo ankyrin repeat 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A014B8G1
Sequence length 139
Comment (tr|A0A014B8G1|A0A014B8G1_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:EXT38683.1} KW=Complete proteome OX=1310912 OS=Acinetobacter sp. 25977_8. GN=J811_1807 OC=Acinetobacter calcoaceticus/baumannii complex.
Sequence
MEIYIYIFFNKQMGCSNQIYEQPSDKYPFEVKMKALLGDNLKIVNSLSKAEVQISSFDLP
TNTNQIDEVVSQLKKDDWVLKGHGQGVDTYCLGLHNKINIVVPISNNVYDYKGRELNITD
HSMNGVSYMYDKWGIDMCE
Download sequence
Identical sequences A0A014B8G1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]