SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A014CGP0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A014CGP0
Domain Number - Region: 17-86
Classification Level Classification E-value
Superfamily Functional domain of the splicing factor Prp18 0.0602
Family Functional domain of the splicing factor Prp18 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A014CGP0
Sequence length 124
Comment (tr|A0A014CGP0|A0A014CGP0_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:EXT53918.1} KW=Complete proteome OX=1310906 OS=Acinetobacter sp. 25977_2. GN=J805_3592 OC=Acinetobacter calcoaceticus/baumannii complex.
Sequence
MSYYHILIEVNDHISTIEQTRDIELFDIIELKPYLHSILLPYFNEQEIELEDENIEYKDI
LHLEVKQTLLPIEHLIEEEQKQLPSDTDVTITAYEIFNDRDLSQDVTSVIFDILEAVKLD
QSII
Download sequence
Identical sequences A0A010K4K9 A0A014AT37 A0A014BND3 A0A014C0K2 A0A014CGP0 A0A014CRD4 A0A014DS56 A0A014EAT9 A0A014F730 A0A062MZG7 A0A062SK38 A0A0E2GFN6 A0A140QUC3 A0A1Y5NQ82 A0A2C9T780 K9BVY5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]