SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A014M0M6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A014M0M6
Domain Number - Region: 106-147
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00017
Family NfeD domain-like 0.0074
Further Details:      
 
Domain Number - Region: 14-80
Classification Level Classification E-value
Superfamily ABC transporter involved in vitamin B12 uptake, BtuC 0.0235
Family ABC transporter involved in vitamin B12 uptake, BtuC 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A014M0M6
Sequence length 155
Comment (tr|A0A014M0M6|A0A014M0M6_9GAMM) Membrane protein {ECO:0000313|EMBL:EXU75366.1} KW=Complete proteome; Reference proteome OX=69222 OS=Erwinia mallotivora. GN=BG55_11615 OC=Erwiniaceae; Erwinia.
Sequence
MMAELFANPWLLWLAIGGLLLVAEMLGTSGYLLWSGMAALLVSLLVWLVPLSWEWQSISF
AILTVLSALGWYYWLKSRQRKQPDSFLNQRGGQLTGRRLTLDQPLVDGFGHVKIGDSSWR
VQAAEDYPAGTQVVVVAVEGITLQIIRFAEYSPAP
Download sequence
Identical sequences A0A014M0M6
WP_034937507.1.3328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]