SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A014MJ23 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A014MJ23
Domain Number 1 Region: 19-166
Classification Level Classification E-value
Superfamily Serpins 3.4e-16
Family Serpins 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A014MJ23
Sequence length 181
Comment (tr|A0A014MJ23|A0A014MJ23_9ACTN) Aromatic ring-opening dioxygenase LigA {ECO:0000313|EMBL:EXU61555.1} KW=Complete proteome OX=1158056 OS=Streptomyces sp. PRh5. GN=Z951_46665 OC=Streptomyces.
Sequence
MIDATAVRAVNTMTARWARAAVADEGTAFAATGVWPLLALLAGGADGPARQELAGALGVG
ADGATALGGRLLGSLDAMDGVHAATGLWTRQDLPIRPEWEAELPPGVRSTLTGDAERDRK
ELDGWASRRTRGAIAEMPVPLTPDTRLVLAGALTVETAWLQPFRPGWLRPASGPWRDRSP
A
Download sequence
Identical sequences A0A014MJ23

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]