SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A014MVK1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A014MVK1
Domain Number 1 Region: 6-133
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.000000000000265
Family Regulator of G-protein signaling, RGS 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A014MVK1
Sequence length 190
Comment (tr|A0A014MVK1|A0A014MVK1_9HYPO) Uncharacterized protein {ECO:0000313|EMBL:EXU95170.1} KW=Complete proteome OX=568076 OS=Metarhizium robertsii. GN=X797_011744 OC=Metarhizium.
Sequence
MDTELPTLGDVLVNAASPPWTLHAFTAHLNRHCCLEALLFVLDTQHYAACYEGLVRSNSA
SSSNSNSVAKLWRNLITLYILPTGQRQLNMPEQEREHLLHLPPEPPPNPSELHEACRCAY
DLLNDSLTAFFRTSEPMQDTEDTQSPPDRQPQSQAAATGEDQDGWLRHLFGTNAKRCKQL
VLTLGCTHAK
Download sequence
Identical sequences A0A014MVK1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]