SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A014P070 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A014P070
Domain Number 1 Region: 5-131
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000000000000128
Family Regulator of G-protein signaling, RGS 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A014P070
Sequence length 209
Comment (tr|A0A014P070|A0A014P070_9HYPO) Uncharacterized protein {ECO:0000313|EMBL:EXU94581.1} KW=Complete proteome OX=568076 OS=Metarhizium robertsii. GN=X797_012349 OC=Metarhizium.
Sequence
MDAQLPTLDDILLNNASPPWTLRAFAAYLNQHRCLEVLQFVFDADRYATCYEASVENNAT
SSNNSGAVDVLWRKLMQLYIYPSGRRQLNIPEREREHLLHLPSLPPPHPSELREACRCAY
DLLNDSLAALFHAREPMNPLRRSDPIPRSTGYKSRGLWRRPGRLSCDPELESQATNEDGN
SSSLTRRSRYAFITNVKRIAAALGCAHAT
Download sequence
Identical sequences A0A014P070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]