SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A014P6G2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A014P6G2
Domain Number 1 Region: 513-647
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000000249
Family SMI1/KNR4-like 0.0072
Further Details:      
 
Domain Number 2 Region: 325-425
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000000644
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A014P6G2
Sequence length 894
Comment (tr|A0A014P6G2|A0A014P6G2_9ACTN) Uncharacterized protein {ECO:0000313|EMBL:EXU66622.1} KW=Complete proteome OX=1158056 OS=Streptomyces sp. PRh5. GN=Z951_19050 OC=Streptomyces.
Sequence
MRATFADFTIDPPRFGNGTARYIRCHPDRDRLAIGAGGRVELDFALDGGELPEQLTLTLI
ARVSPLGESLGWAPIDITVNGHAVISRFTVPGGARPREAAFAVPGEALVAGLNTLCVRGC
AEARGLLWLYRISVEPSRICARTHLMAEERPAEAAVCAYRTEWRAPGSAEWRPAPRLLVH
LDRGEGSLPVRLAWRAQDGREASIGFQPAMTEFYGHRRAADGTLTEYRGVLEGRSPLRDS
ALEEVMHRFRTVEGCGSRGPGLRQELRLLIEDGGPPVERVIWGDPSGHSGTVSLLAAEPG
PEAEVTDLVTKVRAHSEFAEAGEVAENLLHDSRHKWLGHGDRAWLEFTLRRPVAVGHYVL
TSADDVPGRDPKDWTLKGSNDGEHWADLDSRVEESFAHRHQPRGFTFAATTAYRHYRLEI
TRNAGEDQIQLSQVRLFTSAPQPKGFIGHYQRAGEAPTGYRGTSVSAAPEPGSVTGPPRT
VEQWRSYLAEYSATILRVADEDELSEVDDEQRAAGWLGFEGADEESVLALEERLGTRLPP
SYRAFLGASDGWLNISPFMWRMRPAKTVGWLREADPETWSVIRGGEGEDWDDTAFMDRAL
LVSEEGDAQHWLLDPADVSEDGEWAAYIWASWYPALGDRHASFAELVVEERKGFEGRAAH
EARMGRPGTVEDLVAEGRAQALRGEVRKAMATFEQAAVKGSGAGAYLGIILGAFLDISAA
HHWIRTGILGDPRVLEAIGMEQLRAEAAPLYLRCAAEEWTGAPGGYLSALGDILPRLPDG
VDGVVGAGGVAASGAAAEGDDTAAWMARAAAFAPPVLPESRTFQQALDLARTLADRGATD
QSWAVLEAALPHWHCDSPHRIAPVVLLTDPAFREVVTPARARRVVTTPRGEFRE
Download sequence
Identical sequences A0A014P6G2
WP_037953944.1.87540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]