SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A014PU10 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A014PU10
Domain Number 1 Region: 14-173
Classification Level Classification E-value
Superfamily Lipocalins 5.92e-48
Family Retinol binding protein-like 0.00000118
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A014PU10
Sequence length 174
Comment (tr|A0A014PU10|A0A014PU10_9GAMM) Outer membrane lipoprotein Blc {ECO:0000256|PIRNR:PIRNR036893} KW=Complete proteome; Reference proteome OX=69222 OS=Erwinia mallotivora. GN=BG55_18215 OC=Erwiniaceae; Erwinia.
Sequence
MSLWKMLAAGAGALLSVACSTTPPKGVVPIEGFNASLYLGSWYEIARLDHSFERGLEQVT
ATYSKRDDGGLKVVNRGYNVKKQRWQESTGKAYFTASPSRASLKVSFFGPFYGGYNVIAL
DKDYQYALVCGPNRNYLWILSRQPQLPEQVKEQLLTQARQAGFDVTKLIWVTQK
Download sequence
Identical sequences A0A014PU10
WP_034939961.1.3328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]