SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A015IBC1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A015IBC1
Domain Number 1 Region: 11-221
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000000743
Family G proteins 0.04
Further Details:      
 
Weak hits

Sequence:  A0A015IBC1
Domain Number - Region: 234-302
Classification Level Classification E-value
Superfamily OmpH-like 0.0327
Family OmpH-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A015IBC1
Sequence length 354
Comment (tr|A0A015IBC1|A0A015IBC1_9GLOM) Uncharacterized protein {ECO:0000313|EMBL:EXX54497.1} KW=Complete proteome; Reference proteome OX=1432141 OS=Rhizophagus irregularis DAOM 197198w. GN=RirG_233990 OC=Glomerales; Glomeraceae; Rhizophagus.
Sequence
MRIDEQNTNTPNNKRNILLVGKTGNGKSTIANVLVNSEQADTFKESDRSSSETKQAKSEM
FEVTYGNEKIIYQIIDTVGLCDTDMDEKDIFLRLSEAIELLNGEINQILFIVGGRFSKEE
NEVYNIFKSILFFDSECNISNYTTVVRTRFSDFEDRNECEIDRKILEEKIPDDIHIIYVD
NPSLKGNENKINVSKESRKASKEVLMRHLLDYCRKNYRPSSLKLINDRINEHVKKGKELE
KEEKNLQEQLRKAKELGNHENEKQIQKKIDNTKKSIENENKKKSEKMKRGLIDVINQAGE
NWKYAAVTGVEQGNKVLPLVGGAVGGAIGVSVGAVGTAFSALGYVFTKIVGGEI
Download sequence
Identical sequences A0A015IBC1 A0A2H5TGH2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]