SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A015IGS6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A015IGS6
Domain Number 1 Region: 29-166
Classification Level Classification E-value
Superfamily PH domain-like 3.49e-50
Family Ran-binding domain 0.00000778
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A015IGS6
Sequence length 221
Comment (tr|A0A015IGS6|A0A015IGS6_9GLOM) Yrb1p {ECO:0000313|EMBL:EXX53200.1} KW=Complete proteome; Reference proteome OX=1432141 OS=Rhizophagus irregularis DAOM 197198w. GN=RirG_246130 OC=Glomerales; Glomeraceae; Rhizophagus.
Sequence
MADTADTENKQVVTESSRGTEEEDVVPSPDIHFEPLVSLDEVEVKTFEEDEDVLFKMRAK
LFRFDKPLKEWKERGTGDVRFLQHKETKKIRLVMRRDKTHKVCANHYITSEMQLSPNVGS
DRSWVWNVNADVSDGEPKAETLAIRFANIENANSFKEKFYEMQKMNIEIKEAKKNETPKK
DDEKNNVKDEKDKKDEKDEKKQKDEKDEKDEKDEKDEEKTS
Download sequence
Identical sequences A0A015IGS6 A0A2H5RM43 A0A2I1EN80

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]