SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A015IKK3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A015IKK3
Domain Number - Region: 11-58
Classification Level Classification E-value
Superfamily TrpR-like 0.000445
Family SPO1678-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A015IKK3
Sequence length 138
Comment (tr|A0A015IKK3|A0A015IKK3_9GLOM) Uncharacterized protein {ECO:0000313|EMBL:EXX57682.1} KW=Complete proteome; Reference proteome OX=1432141 OS=Rhizophagus irregularis DAOM 197198w. GN=RirG_204950 OC=Glomerales; Glomeraceae; Rhizophagus.
Sequence
MTRNRTKVLRIKRSRTSYSVNQKNKVITYAKQHRGNEAARTFHLNASMVERWVTASKSWD
TEINQNCKRIGSGQKAFYPEAERMLYVWLIEQRKQGLAIIYYTILRIKMQEILKEPEMIF
LYNDSANNLSHIGGYPLS
Download sequence
Identical sequences A0A015IKK3 A0A2H5SL11

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]