SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A015IWH8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A015IWH8
Domain Number 1 Region: 25-74,217-304
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 8.24e-21
Family Regulator of G-protein signaling, RGS 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A015IWH8
Sequence length 370
Comment (tr|A0A015IWH8|A0A015IWH8_9GLOM) Rax1p {ECO:0000313|EMBL:EXX58640.1} KW=Complete proteome; Reference proteome OX=1432141 OS=Rhizophagus irregularis DAOM 197198w. GN=RirG_196120 OC=Glomerales; Glomeraceae; Rhizophagus.
Sequence
MGSQEITINKSSEKSQHLAKARYHSYKLDRLPTLQEVLSRKTAPPVCLFNFYLYMRDREN
TSEYLDFYLDVLEHEILCKAYVKDLKKLGLDVNIEYPEYERFRPGTSKNGNDKSKYNTFI
SVDSSVRRYLSSSSRGSNNTYTSGGREPSSRPDSPFSQNSNLGINLTEISIDVNNNNNNN
NNNNNNNNDKNQKNEGFRNSVRSNKTNITSSFHNRERPFTRDELRESAERIYFKYIFEGS
EKEIILSRDIREKITHAIEEEGISQHKRDDPWIYYEAKKEIFTFMESEPFPRFLKCRAFG
NMSQLQIIMRLFIGLFFLFLGFSIVLSLIFLDIKPKTIRLWSFIPIFLGVKSLITYLTKL
SPLFVLLKIR
Download sequence
Identical sequences A0A015IWH8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]