SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A015KDY6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A015KDY6
Domain Number 1 Region: 5-52,94-165
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.31e-23
Family Regulator of G-protein signaling, RGS 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A015KDY6
Sequence length 237
Comment (tr|A0A015KDY6|A0A015KDY6_9GLOM) Uncharacterized protein {ECO:0000313|EMBL:EXX57786.1} KW=Complete proteome; Reference proteome OX=1432141 OS=Rhizophagus irregularis DAOM 197198w. GN=RirG_203810 OC=Glomerales; Glomeraceae; Rhizophagus.
Sequence
MRSLAKTKPTLSDVLNNETSYPYSLDDFATFLDQTFCLENLEFYLAVKRYRYYASNYFNS
NNSATSLLMSDITDIPEVPEDYYFDDASLRGDTPAHMEFLKQKLVDIITTFILPNSPKEI
NILSVTRDDLLTNVFQYNNYHPSILDPVRNQVYELMQASSFNQFLLEAGNTELRMSSEES
EGVDSDYSSSSSSGVNFRGITRSTNKNNRTKQTFGAGLKQKYRKLIKTTSSKINGNN
Download sequence
Identical sequences A0A015KDY6 A0A2H5UAZ2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]