SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A015KJ58 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A015KJ58
Domain Number - Region: 128-165
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0112
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A015KJ58
Sequence length 218
Comment (tr|A0A015KJ58|A0A015KJ58_9GLOM) Sdc1p {ECO:0000313|EMBL:EXX59691.1} KW=Complete proteome; Reference proteome OX=1432141 OS=Rhizophagus irregularis DAOM 197198w. GN=RirG_186860 OC=Glomerales; Glomeraceae; Rhizophagus.
Sequence
MYSRESDTLKTTSQYSAKQTDNSTYVPLLERDEQENSTYTDSSPADTSTNEYENRRAVGA
VRSIRDILNADSQSPIKREEIDVDITGDEPSEDQPSPFKFEDQFGEVVDEERDKIQRLNV
RHPHSSTAVRDYLNKTVVPTLLAGMKKMVRERPQNPCEFLGRYLIEHCDHDHDHKEESNT
EVRIKQEDTDYSPRSRQKQRRGSGSSADNGDMDVDDDV
Download sequence
Identical sequences A0A015KJ58 A0A2I1E2S7 U9SI06

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]