SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A015KK02 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A015KK02
Domain Number - Region: 132-187
Classification Level Classification E-value
Superfamily Prefoldin 0.00366
Family Prefoldin 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A015KK02
Sequence length 201
Comment (tr|A0A015KK02|A0A015KK02_9GLOM) Uncharacterized protein {ECO:0000313|EMBL:EXX67894.1} KW=Complete proteome; Reference proteome OX=1432141 OS=Rhizophagus irregularis DAOM 197198w. GN=RirG_110110 OC=Glomerales; Glomeraceae; Rhizophagus.
Sequence
MIDNGGELAEVIKTCKERIIHVDNPPIDVKGERLKCNKENRKVLKEILLKNLIKFDETYK
SKNFYRERHENLENFIGEKEKIIKQVKEIKSKLPRYDYGKKLVDCSDELVEGSVGIANLI
QPDNFPISNAGGNIAKFGVKILSVGVNYVLDEKENQLIEKFKNKIKEDRENQEKYLSKLN
FVEKKINFPEFGWLEYIELSI
Download sequence
Identical sequences A0A015KK02 A0A2H5RCU7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]