SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A015KMJ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A015KMJ3
Domain Number 1 Region: 67-143
Classification Level Classification E-value
Superfamily HMG-box 0.00000000684
Family HMG-box 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A015KMJ3
Sequence length 290
Comment (tr|A0A015KMJ3|A0A015KMJ3_9GLOM) Uncharacterized protein {ECO:0000313|EMBL:EXX60956.1} KW=Complete proteome; Reference proteome OX=1432141 OS=Rhizophagus irregularis DAOM 197198w. GN=RirG_175320 OC=Glomerales; Glomeraceae; Rhizophagus.
Sequence
MTLSLKQDWEIRLRPLYIKYAENDRINLFNIINQFECNEIYNPNIDVHEIFEHIYKQSSH
EGGLTAKRQPNPFMIFRTALGITASRKCVKLRDGTCQSKIAGLLWRGATQHEKKNFETLS
LKFKNLHKQKFPGYEYRPKARNPVSGTFVDMNNNFGTRIDSNNQSMSQISQQIQQISKDN
NATWDQPSSFTFTGYAAGLEGLDSNFMIGGLQYQLQQEQTQFYQIPQFPLPEMYVPQTYL
PTELYPTNPLNNEININKVEYFQQAPPPSIAENCPIQCFDFNNGIDFHFG
Download sequence
Identical sequences A0A015KMJ3 A0A1B1EVI7 U9TCS8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]