SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A015LA68 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A015LA68
Domain Number - Region: 32-64
Classification Level Classification E-value
Superfamily Stathmin 0.0562
Family Stathmin 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A015LA68
Sequence length 67
Comment (tr|A0A015LA68|A0A015LA68_9GLOM) Uncharacterized protein {ECO:0000313|EMBL:EXX51678.1} KW=Complete proteome; Reference proteome OX=1432141 OS=Rhizophagus irregularis DAOM 197198w. GN=RirG_259650 OC=Glomerales; Glomeraceae; Rhizophagus.
Sequence
MKTDDAITLVSRLISPNDFSKNSNLFSNKTLKRDFRDHIKADDETRMDYEMQKYDQWGER
IQHRGAR
Download sequence
Identical sequences A0A015LA68

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]