SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A015LTL3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A015LTL3
Domain Number 1 Region: 65-190
Classification Level Classification E-value
Superfamily EF-hand 3.67e-38
Family Penta-EF-hand proteins 0.00044
Further Details:      
 
Weak hits

Sequence:  A0A015LTL3
Domain Number - Region: 12-76
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00167
Family beta-sandwich domain of Sec23/24 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A015LTL3
Sequence length 198
Comment (tr|A0A015LTL3|A0A015LTL3_9GLOM) Pef1p {ECO:0000313|EMBL:EXX76016.1} KW=Complete proteome; Reference proteome OX=1432141 OS=Rhizophagus irregularis DAOM 197198w. GN=RirG_036850 OC=Glomerales; Glomeraceae; Rhizophagus.
Sequence
MSFYNNNQGGYRPPPQSQGSQYGAPPQGYVQQGPPPQGAYGQPGGYQYPPPQQQQNRPPN
SGSAPAQPPPGVDQQLYFWFQAVDTDKSGALTTEELQKALINGDWSPFNIETVRLMMNMF
DTDNSGTIAFQEFTGLWRYIEDWKKCFQTFDADGSGTINFAELKNALRTFGYNLSDNFIN
LLIKKYDKYGECNFLFIH
Download sequence
Identical sequences A0A015LTL3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]