SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A015MHZ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A015MHZ3
Domain Number - Region: 22-56
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 0.0745
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A015MHZ3
Sequence length 69
Comment (tr|A0A015MHZ3|A0A015MHZ3_9BACL) Protein translocase subunit SecE {ECO:0000256|HAMAP-Rule:MF_00422} KW=Complete proteome; Reference proteome OX=1380763 OS=Paenibacillus darwinianus. GN=BG52_00605 OC=Paenibacillus.
Sequence
MTFLARMKQGFGSSFAFFADSWAELKKVRWPSRKELTSYTVVVLVTILLVTIYFWLLDIG
ISSLVELIV
Download sequence
Identical sequences A0A015MHZ3
WP_036580000.1.22916 WP_036580000.1.7592 WP_036580000.1.76732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]