SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A015MJY6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A015MJY6
Domain Number - Region: 49-92
Classification Level Classification E-value
Superfamily Copper amine oxidase, domain N 0.000111
Family Copper amine oxidase, domain N 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A015MJY6
Sequence length 187
Comment (tr|A0A015MJY6|A0A015MJY6_9BACL) Copper amine oxidase {ECO:0000313|EMBL:EXX85571.1} KW=Complete proteome; Reference proteome OX=1380763 OS=Paenibacillus darwinianus. GN=BG52_08165 OC=Paenibacillus.
Sequence
MKLKKLLVLVVLLSIWGGTMILADAASQRVKVIVNGSELNETGLLEENKTYLPLRQIAGA
LQSLISWDESTKRVALNKPNVHMFLFKDTTVFGKVNKGSKVTFSAWAQVDSLTTDISAFK
IVIAGPDGKEDLIQSQEVASQKDNFWFRTKEVRYLFDSSGNYPVRMYMKPSRSDEWNLVS
EKLIIAE
Download sequence
Identical sequences A0A015MJY6
WP_036580502.1.22916 WP_036580502.1.7592 WP_036580502.1.76732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]