SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A015N273 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A015N273
Domain Number - Region: 13-89
Classification Level Classification E-value
Superfamily Aerolisin/ETX pore-forming domain 0.068
Family (Pro)aerolysin, pore-forming lobe 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A015N273
Sequence length 113
Comment (tr|A0A015N273|A0A015N273_9GLOM) Uncharacterized protein {ECO:0000313|EMBL:EXX73203.1} KW=Complete proteome; Reference proteome OX=1432141 OS=Rhizophagus irregularis DAOM 197198w. GN=RirG_062300 OC=Glomerales; Glomeraceae; Rhizophagus.
Sequence
MSLHHFNVFSDNNNSDHEYNSEFIDNSLQQPYYENVSNTTGDYVTIQNSNIQESISTSNL
QYHQASLQHDEHVQQNDFASTPHDYDNASAKVSIPKISKRIDSSQNQILKNCY
Download sequence
Identical sequences A0A015N273 U9U4U8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]