SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A015N811 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A015N811
Domain Number - Region: 54-105
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 0.0497
Family Oxysterol-binding protein 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A015N811
Sequence length 124
Comment (tr|A0A015N811|A0A015N811_9GLOM) rRNA-processing protein {ECO:0000256|RuleBase:RU363084} KW=Complete proteome; Reference proteome OX=1432141 OS=Rhizophagus irregularis DAOM 197198w. GN=RirG_042900 OC=Glomerales; Glomeraceae; Rhizophagus.
Sequence
MNLDKHSDPTPNTEPSASTNIKKLSITRRVSGKTWKHPKTATRRSQLPRSLRKNWNEKLK
ERNEREALKMLEKEMKEEREAEKKRKLEIALKRKQRLEEKERQEKLITIPMKFEDYLHYL
HVII
Download sequence
Identical sequences A0A015N811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]