SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A015PX19 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A015PX19
Domain Number - Region: 50-108
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00169
Family SMI1/KNR4-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A015PX19
Sequence length 112
Comment (tr|A0A015PX19|A0A015PX19_BACFG) Uncharacterized protein {ECO:0000313|EMBL:EXY26076.1} KW=Complete proteome OX=1339284 OS=Bacteroides fragilis str. 3397 T10. GN=M080_3491 OC=Bacteroides.
Sequence
KKRPASQTEAMKLRWKKRIVFEKGYTEMCAEWMAERLEALTDHLQYGHAAIAYQKQNGDF
RLVKATLIYYEAEFHKKYDPTKIEGAVVYWNVDEQRWTTFQVENFMEWRPIV
Download sequence
Identical sequences A0A015PX19

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]