SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A015QKX1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A015QKX1
Domain Number - Region: 37-98
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00118
Family SMI1/KNR4-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A015QKX1
Sequence length 102
Comment (tr|A0A015QKX1|A0A015QKX1_BACFG) Uncharacterized protein {ECO:0000313|EMBL:EXY26053.1} KW=Complete proteome OX=1339284 OS=Bacteroides fragilis str. 3397 T10. GN=M080_3541 OC=Bacteroides.
Sequence
MKLRWKKRIVFEKGYTEQCAEWMAERLEALTDHLQYGHAAIAYQKQNGDFRLVKATLIYY
EAEFHKKYDPTQIEGAVVYWNVDEQRWTTFQMENFMEWRPIV
Download sequence
Identical sequences A0A015QKX1 A0A015VSE8 A0A015YH15 A0A015ZEV7
WP_050441887.1.97349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]