SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A015QRB1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A015QRB1
Domain Number 1 Region: 15-110
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 3.14e-20
Family N-utilization substance G protein NusG, N-terminal domain 0.0038
Further Details:      
 
Weak hits

Sequence:  A0A015QRB1
Domain Number - Region: 113-158
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.013
Family N-utilization substance G protein NusG, C-terminal domain 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A015QRB1
Sequence length 176
Comment (tr|A0A015QRB1|A0A015QRB1_BACFG) Transcription termination factor nusG family protein {ECO:0000313|EMBL:EXY27963.1} KW=Complete proteome OX=1339284 OS=Bacteroides fragilis str. 3397 T10. GN=M080_1605 OC=Bacteroides.
Sequence
MEETARKIKENTSCWYAVYTAPRAEKKVKEQLDKIGVENYLPLQPVVRLWNNRKKKIFIP
VVPGCLFVHISSEEIAHVAGIHGVAFLLKEKGQYVSIPEVQMETFKTMIEHSCELVEFAP
NEFVPGTIVRVISGQLQGLEAELVECQGNNKLLLRVEGLGCALVTVSTDCVASKEE
Download sequence
Identical sequences A0A015QRB1 A0A015ZTT2 A0A0E2AS85 D1JL06 F7LNV3
WP_005795022.1.11335 WP_005795022.1.36984 WP_005795022.1.42362 WP_005795022.1.51763 WP_005795022.1.53910 WP_005795022.1.55270 WP_005795022.1.81678 WP_005795022.1.89819 WP_005795022.1.93759 WP_005795022.1.95091 WP_005795022.1.98903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]