SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A015T2I4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A015T2I4
Domain Number - Region: 2-97
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000255
Family SMI1/KNR4-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A015T2I4
Sequence length 120
Comment (tr|A0A015T2I4|A0A015T2I4_BACFG) Uncharacterized protein {ECO:0000313|EMBL:EXY76732.1} KW=Complete proteome OX=1339315 OS=Bacteroides fragilis str. 3988T(B)14. GN=M124_4376 OC=Bacteroides.
Sequence
METNGASILDYCFLGMKNNQLGINVYDNIRELWQVDNLLTFRFWGVIGTSCGENFGYLDK
IDSDGNHFIGYYNTNEPEQVYLVASSFDIFMSKFLKQIENTLKLDENAICIANNDWFLNK
Download sequence
Identical sequences A0A015T2I4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]