SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A015U0X0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A015U0X0
Domain Number - Region: 63-111
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00863
Family SMI1/KNR4-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A015U0X0
Sequence length 115
Comment (tr|A0A015U0X0|A0A015U0X0_BACFG) Uncharacterized protein {ECO:0000313|EMBL:EXY76831.1} KW=Complete proteome OX=1339315 OS=Bacteroides fragilis str. 3988T(B)14. GN=M124_4290 OC=Bacteroides.
Sequence
MKKLKSPASQSEAMKLRWKKRIVFEKGYTESCAEWMAERLEALLDHMQYGHATVAYRKQN
GSFQLVKATLIYYEAEFRKKYDPTKIEGAVVYWNVDEQRWMTFQVENFMEWRPIA
Download sequence
Identical sequences A0A015U0X0 R6Z8S9
WP_022347958.1.49420 WP_022347958.1.93484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]